Emerin (EMD) (NM_000117) Human Recombinant Protein

CAT#: TP300643

Recombinant protein of human emerin (EMD), 20 µg

Product Images

Coomassie blue staining of purified EMD protein (Cat# TP300643). The protein was produced from HEK293T cells transfected with EMD cDNA clone (Cat# RC200643) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200643 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSPPSSSAASSYSFSDLNSTRGD
  ADMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTYGEPESAGPSRAVRQSVTSFPDADAFHHQVHDDDLL
  SSSEEECKDRERPMYGRDSAYQSITHYRPVSASRSSLDLSYYPTSSSTSFMSSSSSSSSWLTRRAIRPEN
  RAPGAGLGQDRQVPLWGQLLLFLVFVIVLFFIYHFMQAEEGNPF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000108
• Locus ID: 2010
• UniProt ID: P50402
• Cytogenetics: Xq28
• Refseq Size: 1370
• Refseq ORF: 762
• Synonyms: EDMD; LEMD5; STA
• Summary: Emerin is a serine-rich nuclear membrane protein and a member of the nuclear lamina-associated protein family. It mediates membrane anchorage to the cytoskeleton. Dreifuss-Emery muscular dystrophy is an X-linked inherited degenerative myopathy resulting from mutation in the emerin gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM)