CD70 (NM_001252) Human Recombinant Protein

CAT#: TP300410M

Recombinant protein of human CD70 molecule (CD70), 100 µg

Product Images

The binding affinity values of IgG and DuetMab with amino acid residue substitutions of the heavy chain and kappa light chain variable domains and their combinations of some of the substitutions to CD4 and CD70 (OriGene TP300410), as measured using an Octet384 instrument. Figure cited from MAbs, PMID: 25730144

• 

  Coomassie blue staining of purified CD70 protein (Cat# TP300410). The protein was produced from HEK293T cells transfected with CD70 cDNA clone (Cat# RC200410) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200410 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQD
  PRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSI
  SLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: In vitro binding assay (PMID: 25730144)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001243
• Locus ID: 970
• UniProt ID: P32970, A0A0U5JA32
• Cytogenetics: 19p13.3
• Refseq Size: 913
• Refseq ORF: 579
• Synonyms: CD27-L; CD27L; CD27LG; LPFS3; TNFSF7; TNLG8A
• Summary: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. [provided by RefSeq, Jul 2008]
• Protein Families: ES Cell Differentiation/IPS, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction