MTFR1L (NM_019557) Human Recombinant Protein

CAT#: TP300212M

Recombinant protein of human family with sequence similarity 54, member B (FAM54B), transcript variant 1, 100 µg

Product Images

Coomassie blue staining of purified MTFR1L protein (Cat# TP300212). The protein was produced from HEK293T cells transfected with MTFR1L cDNA clone (Cat# RC200212) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200212 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGMEATVTIPIWQNKPHGAARSVVRRIGTNLPLKPCARASFETLPNISDLCLRDVPPVPTLADIAWIAA
  DEEETYARVRSDTRPLRHTWKPSPLIVMQRNASVPNLRGSEERLLALKKPALPALSRTTELQDELSHLRS
  QIAKIVAADAASASLTPDFLSPGSSNVSSPLPCFGSSFHSTTSFVISDITEETEVEVPELPSVPLLCSAS
  PECCKPEHKAACSSSEEDDCVSLSKASSFADMMGILKDFHRMKQSQDLNRSLLKEEDPAVLISEVLRRKF
  ALKEEDISRKGN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_062457
• Locus ID: 56181
• UniProt ID: Q9H019, A0A0S2Z5H6
• Cytogenetics: 1p36.11
• Refseq Size: 2120
• Refseq ORF: 876
• Synonyms: FAM54B; HYST1888; MST116; MSTP116