NDE1 (NM_017668) Human Recombinant Protein
CAT#: TP300179
Recombinant protein of human nudE nuclear distribution gene E homolog 1 (A. nidulans) (NDE1), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200179 protein sequence
Red=Cloning site Green=Tags(s) MEDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNR LRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQ RLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQKQEKPRTPMPSSVEAERTDTAVQATG SVPSTPIAHRGPSSSLNTPGSFRRGLDDSTGGTPLTPAARISALNIVGDLLRKVGALESKLASCRNLVYD QSPNRTGGPASGRSSKNRDGGERRPSSTSVPLGDKGLDTSCRWLSKSTTRSSSSC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060138 |
Locus ID | 54820 |
UniProt ID | Q9NXR1, X5DR54 |
Cytogenetics | 16p13.11 |
Refseq Size | 3222 |
Refseq ORF | 1005 |
Synonyms | HOM-TES-87; LIS4; MHAC; NDE; NUDE; NUDE1 |
Summary | This gene encodes a member of the nuclear distribution E (NudE) family of proteins. The encoded protein is localized at the centrosome and interacts with other centrosome components as part of a multiprotein complex that regulates dynein function. This protein plays an essential role in microtubule organization, mitosis and neuronal migration. Mutations in this gene cause lissencephaly 4, a disorder characterized by lissencephaly, severe brain atrophy, microcephaly, and severe cognitive disability. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2012] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402606 | NDE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428439 | NDE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402606 | Transient overexpression lysate of nudE nuclear distribution gene E homolog 1 (A. nidulans) (NDE1), transcript variant 2 |
USD 436.00 |
|
LY428439 | Transient overexpression lysate of nudE nuclear distribution gene E homolog 1 (A. nidulans) (NDE1), transcript variant 1 |
USD 436.00 |
|
PH300179 | NDE1 MS Standard C13 and N15-labeled recombinant protein (NP_060138) |
USD 3,255.00 |
|
PH327919 | NDE1 MS Standard C13 and N15-labeled recombinant protein (NP_001137451) |
USD 3,255.00 |
|
TP327919 | Recombinant protein of human nudE nuclear distribution gene E homolog 1 (A. nidulans) (NDE1), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review