PAK1 (NM_001128620) Human Mass Spec Standard
CAT#: PH325947
PAK1 MS Standard C13 and N15-labeled recombinant protein (NP_001122092)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225947 |
Predicted MW | 61.5 kDa |
Protein Sequence |
>RC225947 representing NM_001128620
Red=Cloning site Green=Tags(s) MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEK ERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQ KYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLP VTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGA SGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGG SLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKL SAIFRDFLNRCLEMDVEKRGSAKELLQVRKLRFQVFSNFSMIAASIPEDCQAPLQPHSTDCCS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001122092 |
RefSeq ORF | 1659 |
Synonyms | alpha-PAK; IDDMSSD; p65-PAK; PAKalpha |
Locus ID | 5058 |
UniProt ID | Q13153 |
Cytogenetics | 11q13.5-q14.1 |
Summary | This gene encodes a family member of serine/threonine p21-activating kinases, known as PAK proteins. These proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling, and they serve as targets for the small GTP binding proteins Cdc42 and Rac. This specific family member regulates cell motility and morphology. Mutations in this gene have been associated with macrocephaly, seizures, and speech delay. Overexpression of this gene is also reported in many cancer types, and particularly in breast cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2020] |
Protein Families | Druggable Genome, Protein Kinase, Stem cell - Pluripotency |
Protein Pathways | Axon guidance, Chemokine signaling pathway, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC426982 | PAK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY426982 | Transient overexpression lysate of p21 protein (Cdc42/Rac)-activated kinase 1 (PAK1), transcript variant 1 |
USD 436.00 |
|
TP325947 | Recombinant protein of human p21 protein (Cdc42/Rac)-activated kinase 1 (PAK1), transcript variant 1, 20 µg |
USD 867.00 |
|
TP723901 | Purified recombinant kinase domain protein of human p21 protein (Cdc42/Rac)-activated kinase 1 (PAK1), transcript variant 1, 10 ug |
USD 765.00 |
|
TP723902 | Purified recombinant kinase domain protein of human p21 protein (Cdc42/Rac)-activated kinase 1 (PAK1), transcript variant 1, and phosphorylated at amino acid T423, 100 ug |
USD 2,635.00 |
{0} Product Review(s)
Be the first one to submit a review