NUDT7 (NM_001105663) Human Mass Spec Standard

CAT#: PH325300

NUDT7 MS Standard C13 and N15-labeled recombinant protein (NP_001099133)

Product Images

Coomassie blue staining of purified NUDT7 protein (Cat# TP325300). The protein was produced from HEK293T cells transfected with NUDT7 cDNA clone (Cat# RC225300) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC225300
• Predicted MW: 26.8 kDa
• Protein Sequence:
  Sequence Link

  >RC225300 representing NM_001105663
  Red=Cloning site Green=Tags(s)
  
  MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGE
  VCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTLITPFVGLIDHNFQAQPNPAE
  VKDVFLVPLAYFLHPQVHDQHYVTRLGHRFINHIFEYTNPEDGVTYQIKGMTANLAVLVAFIILEKKPTF
  EVQFNLNDVLASSEELFLKVHKKATSRL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001099133
• RefSeq ORF: 714
• Locus ID: 283927
• UniProt ID: P0C024
• Cytogenetics: 16q23.1
• Summary: The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq, Aug 2011]