NUDT7 (NM_001105663) Human Mass Spec Standard
CAT#: PH325300
NUDT7 MS Standard C13 and N15-labeled recombinant protein (NP_001099133)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225300 |
Predicted MW | 26.8 kDa |
Protein Sequence |
>RC225300 representing NM_001105663
Red=Cloning site Green=Tags(s) MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGE VCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTLITPFVGLIDHNFQAQPNPAE VKDVFLVPLAYFLHPQVHDQHYVTRLGHRFINHIFEYTNPEDGVTYQIKGMTANLAVLVAFIILEKKPTF EVQFNLNDVLASSEELFLKVHKKATSRL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001099133 |
RefSeq ORF | 714 |
Locus ID | 283927 |
UniProt ID | P0C024 |
Cytogenetics | 16q23.1 |
Summary | The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC426294 | NUDT7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY426294 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 7 (NUDT7), transcript variant 1 |
USD 436.00 |
|
TP325300 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 7 (NUDT7), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review