hnRNP R (HNRNPR) (NM_001102397) Human Mass Spec Standard

CAT#: PH324683

HNRNPR MS Standard C13 and N15-labeled recombinant protein (NP_001095867)

Product Images

Coomassie blue staining of purified HNRNPR protein (Cat# TP324683). The protein was produced from HEK293T cells transfected with HNRNPR cDNA clone (Cat# RC224683) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224683
• Predicted MW: 59.5 kDa
• Protein Sequence:
  Sequence Link

  >RC224683 representing NM_001102397
  Red=Cloning site Green=Tags(s)
  
  MKTYRQREKQGSKVQESTKGPDEAKIKALLERTGYTLDVTTGQRKYGGPPPDSVYSGVQPGIGTEVFVGK
  IPRDLYEDELVPLFEKAGPIWDLRLMMDPLSGQNRGYAFITFCGKEAAQEAVKLCDSYEIRPGKHLGVCI
  SVANNRLFVGSIPKNKTKENILEEFSKVTEGLVDVILYHQPDDKKKNRGFCFLEYEDHKSAAQARRRLMS
  GKVKVWGNVVTVEWADPVEEPDPEVMAKVKVLFVRNLATTVTEEILEKSFSEFGKLERVKKLKDYAFVHF
  EDRGAAVKAMDEMNGKEIEGEEIEIVLAKPPDKKRKERQAARQASRSTAYEDYYYHPPPRMPPPIRGRGR
  GGGRGGYGYPPDYYGYEDYYDDYYGYDYHDYRGGYEDPYYGYDDGYAVRGRGGGRGGRGAPPPPRGRGAP
  PPRGRAGYSQRGAPLGPPRGSRGGRGGPAQQQRGRGSRGSRGNRGGNVGGKRKADGYNQPDSKRRQTNNQ
  QNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001095867
• RefSeq Size: 2585
• RefSeq ORF: 1596
• Synonyms: hnRNP-R; HNRPR
• Locus ID: 10236
• UniProt ID: Q0VGD6
• Cytogenetics: 1p36.12
• Summary: This gene encodes an RNA-binding protein that is a member of the spliceosome C complex, which functions in pre-mRNA processing and transport. The encoded protein also promotes transcription at the c-fos gene. Alternative splicing results in multiple transcript variants. There are pseudogenes for this gene on chromosomes 4, 11, and 10. [provided by RefSeq, Jul 2014]