OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MOBKL2C (MOB3C) (NM_201403) Human Mass Spec Standard

Be the first to review this product
SKU
PH324513
MOBKL2C MS Standard C13 and N15-labeled recombinant protein (NP_958805)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA316158 Rabbit polyclonal anti-MOB3C (MOL2C) antibody
100 ul
$380.00
LY404530 Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 2C (yeast) (MOBKL2C), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "MOBKL2C or NM_201403"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224513
Predicted MW 25.6 kDa
Protein Sequence
Protein Sequence
>RC224513 protein sequence
Red=Cloning site Green=Tags(s)

MALCLKQVFAKDKTFRPRKRFEPGTQRFELYKKAQASLKSGLDLRSVVRLPPGENIDDWIAVHVVDFFNR
INLIYGTMAERCSETSCPVMAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDEEVFPTRVG
VPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYFIREFSLVDQRELEPLREM
TERICH

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_958805
RefSeq Size 2822
RefSeq ORF 648
Synonyms MOB1E; MOBKL2C
Locus ID 148932
UniProt ID Q70IA8
Cytogenetics 1p33
Summary The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MOBKL2C" proteins (3)
SKU Description Size Price
LC404530 Lyophilized MOB3C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404530 Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 2C (yeast) (MOBKL2C), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP324513 Recombinant protein of human MOB1, Mps One Binder kinase activator-like 2C (yeast) (MOBKL2C), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products