MOBKL2C (MOB3C) (NM_201403) Human Mass Spec Standard

CAT#: PH324513

MOBKL2C MS Standard C13 and N15-labeled recombinant protein (NP_958805)

Product Images

Coomassie blue staining of purified MOB3C protein (Cat# TP324513). The protein was produced from HEK293T cells transfected with MOB3C cDNA clone (Cat# RC224513) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224513
• Predicted MW: 25.6 kDa
• Protein Sequence:
  Sequence Link

  >RC224513 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALCLKQVFAKDKTFRPRKRFEPGTQRFELYKKAQASLKSGLDLRSVVRLPPGENIDDWIAVHVVDFFNR
  INLIYGTMAERCSETSCPVMAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDEEVFPTRVG
  VPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYFIREFSLVDQRELEPLREM
  TERICH
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_958805
• RefSeq Size: 2822
• RefSeq ORF: 648
• Synonyms: MOB1E; MOBKL2C
• Locus ID: 148932
• UniProt ID: Q70IA8
• Cytogenetics: 1p33
• Summary: The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]