C14orf181 (NM_207442) Human Mass Spec Standard

CAT#: PH324309

C14orf181 MS Standard C13 and N15-labeled recombinant protein (NP_997325)

Product Images

Coomassie blue staining of purified C14orf181 protein (Cat# TP324309). The protein was produced from HEK293T cells transfected with C14orf181 cDNA clone (Cat# RC224309) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224309
• Predicted MW: 17.1 kDa
• Protein Sequence:
  Sequence Link

  >RC224309 representing NM_207442
  Red=Cloning site Green=Tags(s)
  
  MNTYTRSASFTPKTFTFPLAQNRTSHPTTTSKLKYLGRPSPRRDALQANGEGPEVGPGTEEPAHRLPVGS
  GSAGEAAASLGTARVRSGRAECTAKLAGDGHARLASAFLHRRAALPPPLGTCRPRLGEGGSAPALGPSPR
  RGRRVSEGLRDSLPPLGSLTLGKSPK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_997325
• RefSeq Size: 1727
• RefSeq ORF: 498
• Synonyms: FLJ39779
• Locus ID: 400223
• Cytogenetics: 14q24.1
• Summary: DISCONTINUED: This record has been withdrawn by NCBI and HGNC. This record was defined by AK097098.1, which is not sufficient evidence to define a distinct locus.