SEC13L1 (SEC13) (NM_183352) Human Mass Spec Standard
CAT#: PH322811
SEC13 MS Standard C13 and N15-labeled recombinant protein (NP_899195)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222811 |
Predicted MW | 35.5 kDa |
Protein Sequence |
>RC222811 protein sequence
Red=Cloning site Green=Tags(s) MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMY GNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQW EVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEA HSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVS GGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_899195 |
RefSeq Size | 1437 |
RefSeq ORF | 966 |
Synonyms | D3S1231E; npp-20; SEC13L1; SEC13R |
Locus ID | 6396 |
UniProt ID | P55735 |
Cytogenetics | 3p25.3 |
Summary | The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq, Oct 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405245 | SEC13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427864 | SEC13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY405245 | Transient overexpression lysate of SEC13 homolog (S. cerevisiae) (SEC13), transcript variant 1 |
USD 436.00 |
|
LY427864 | Transient overexpression lysate of SEC13 homolog (S. cerevisiae) (SEC13), transcript variant 2 |
USD 436.00 |
|
TP322811 | Recombinant protein of human SEC13 homolog (S. cerevisiae) (SEC13), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review