DAP12 (TYROBP) (NM_003332) Human Mass Spec Standard
CAT#: PH322502
TYROBP MS Standard C13 and N15-labeled recombinant protein (NP_003323)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222502 |
Predicted MW | 12.2 kDa |
Protein Sequence |
>RC222502 protein sequence
Red=Cloning site Green=Tags(s) MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPR GRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003323 |
RefSeq Size | 608 |
RefSeq ORF | 339 |
Synonyms | DAP12; KARAP; PLOSL; PLOSL1 |
Locus ID | 7305 |
UniProt ID | O43914 |
Cytogenetics | 19q13.12 |
Summary | This gene encodes a transmembrane signaling polypeptide which contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. The encoded protein may associate with the killer-cell inhibitory receptor (KIR) family of membrane glycoproteins and may act as an activating signal transduction element. This protein may bind zeta-chain (TCR) associated protein kinase 70kDa (ZAP-70) and spleen tyrosine kinase (SYK) and play a role in signal transduction, bone modeling, brain myelination, and inflammation. Mutations within this gene have been associated with polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL), also known as Nasu-Hakola disease. Its putative receptor, triggering receptor expressed on myeloid cells 2 (TREM2), also causes PLOSL. Multiple alternative transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Mar 2010] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Natural killer cell mediated cytotoxicity |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403671 | TYROBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC418750 | TYROBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403671 | Transient overexpression lysate of TYRO protein tyrosine kinase binding protein (TYROBP), transcript variant 2 |
USD 436.00 |
|
LY418750 | Transient overexpression lysate of TYRO protein tyrosine kinase binding protein (TYROBP), transcript variant 1 |
USD 436.00 |
|
TP322502 | Recombinant protein of human TYRO protein tyrosine kinase binding protein (TYROBP), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review