DAP12 (TYROBP) (NM_003332) Human Mass Spec Standard

CAT#: PH322502

TYROBP MS Standard C13 and N15-labeled recombinant protein (NP_003323)

Product Images

Coomassie blue staining of purified TYROBP protein (Cat# TP322502). The protein was produced from HEK293T cells transfected with TYROBP cDNA clone (Cat# RC222502) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222502
• Predicted MW: 12.2 kDa
• Protein Sequence:
  Sequence Link

  >RC222502 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPR
  GRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003323
• RefSeq Size: 608
• RefSeq ORF: 339
• Synonyms: DAP12; KARAP; PLOSL; PLOSL1
• Locus ID: 7305
• UniProt ID: O43914
• Cytogenetics: 19q13.12
• Summary: This gene encodes a transmembrane signaling polypeptide which contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. The encoded protein may associate with the killer-cell inhibitory receptor (KIR) family of membrane glycoproteins and may act as an activating signal transduction element. This protein may bind zeta-chain (TCR) associated protein kinase 70kDa (ZAP-70) and spleen tyrosine kinase (SYK) and play a role in signal transduction, bone modeling, brain myelination, and inflammation. Mutations within this gene have been associated with polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL), also known as Nasu-Hakola disease. Its putative receptor, triggering receptor expressed on myeloid cells 2 (TREM2), also causes PLOSL. Multiple alternative transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Mar 2010]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Natural killer cell mediated cytotoxicity