RND2 (NM_005440) Human Mass Spec Standard

CAT#: PH321840

RND2 MS Standard C13 and N15-labeled recombinant protein (NP_005431)

Product Images

Coomassie blue staining of purified RND2 protein (Cat# TP321840). The protein was produced from HEK293T cells transfected with RND2 cDNA clone (Cat# RC221840) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221840
• Predicted MW: 25.4 kDa
• Protein Sequence:
  Sequence Link

  >RC221840 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEGQSGRCKIVVVGDAECGKTALLQVFAKDAYPGSYVPTVFENYTASFEIDKRRIELNMWDTSGSSYYDN
  VRPLAYPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELSKQRLIP
  VTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATVASLGRGHRQLRRTDSRRGMQRSAQLSGRPDR
  GNEGEIHKDRAKSCNLM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005431
• RefSeq Size: 4169
• RefSeq ORF: 681
• Synonyms: ARHN; RHO7; RhoN
• Locus ID: 8153
• UniProt ID: P52198
• Cytogenetics: 17q21.31
• Summary: This gene encodes a member of the Rho GTPase family, whose members play a key role in the regulation of actin cytoskeleton organization in response to extracellular growth factors. This particular family member has been implicated in the regulation of neuronal morphology and endosomal trafficking. The gene localizes to chromosome 17 and is the centromeric neighbor of the breast-ovarian cancer susceptibility gene BRCA1. [provided by RefSeq, Jul 2008]