TGIF2LY (NM_139214) Human Mass Spec Standard

CAT#: PH321598

TGIF2LY MS Standard C13 and N15-labeled recombinant protein (NP_631960)

Product Images

Coomassie blue staining of purified TGIF2LY protein (Cat# TP321598). The protein was produced from HEK293T cells transfected with TGIF2LY cDNA clone (Cat# RC221598) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221598
• Predicted MW: 20.6 kDa
• Protein Sequence:
  Sequence Link

  >RC221598 representing NM_139214
  Red=Cloning site Green=Tags(s)
  
  MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMY
  KHRFKAYPSEEEKQMLSEKTNLSLLRISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEA
  SVPAKSGPVVQTMYKACPCGPCQRARCQERSNQIRSRPLARSSPE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_631960
• RefSeq Size: 880
• RefSeq ORF: 555
• Synonyms: TGIFLY
• Locus ID: 90655
• UniProt ID: Q8IUE0
• Cytogenetics: Yp11.2
• Summary: This gene encodes a member of the TALE/TGIF homeobox family of transcription factors. This gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. The C-terminus of this protein is divergent from that of its chromosome X homolog (TGIF2LX), suggesting that this protein may act as a regulator of TGIF2LX. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors