ATP6V1G3 (NM_133262) Human Mass Spec Standard
CAT#: PH321453
ATP6V1G3 MS Standard C13 and N15-labeled recombinant protein (NP_573569)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221453 |
Predicted MW | 13.9 kDa |
Protein Sequence |
>RC221453 protein sequence
Red=Cloning site Green=Tags(s) MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLS DEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_573569 |
RefSeq Size | 645 |
RefSeq ORF | 354 |
Synonyms | ATP6G3; Vma10 |
Locus ID | 127124 |
UniProt ID | Q96LB4 |
Cytogenetics | 1q31.3 |
Summary | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'' and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three G subunit proteins. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | Epithelial cell signaling in Helicobacter pylori infection, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408852 | ATP6V1G3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC408866 | ATP6V1G3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408852 | Transient overexpression lysate of ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 1 |
USD 436.00 |
|
LY408866 | Transient overexpression lysate of ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 2 |
USD 436.00 |
|
PH322686 | ATP6V1G3 MS Standard C13 and N15-labeled recombinant protein (NP_579872) |
USD 3,255.00 |
|
TP321453 | Recombinant protein of human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 1, 20 µg |
USD 867.00 |
|
TP322686 | Recombinant protein of human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review