Calneuron 1 (CALN1) (NM_001017440) Human Mass Spec Standard

CAT#: PH321065

CALN1 MS Standard C13 and N15-labeled recombinant protein (NP_001017440)

Product Images

Coomassie blue staining of purified CALN1 protein (Cat# TP321065). The protein was produced from HEK293T cells transfected with CALN1 cDNA clone (Cat# RC221065) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221065
• Predicted MW: 24.7 kDa
• Protein Sequence:
  Sequence Link

  >RC221065 representing NM_001017440
  Red=Cloning site Green=Tags(s)
  
  MPFHHVTAGLLYKGNYLNRSLSAGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGY
  MPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKHIL
  YHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQNRQTCVRKSLICAFAMAFIISVMLIAA
  NQILRSGME
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001017440
• RefSeq Size: 5802
• RefSeq ORF: 657
• Synonyms: CABP8
• Locus ID: 83698
• UniProt ID: Q9BXU9, A4D1Z1
• Cytogenetics: 7q11.22
• Summary: This gene encodes a protein with high similarity to the calcium-binding proteins of the calmodulin family. The encoded protein contains two EF-hand domains and potential calcium-binding sites. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane