VPS29 (NM_016226) Human Mass Spec Standard

CAT#: PH319311

VPS29 MS Standard C13 and N15-labeled recombinant protein (NP_057310)

Product Images

Coomassie blue staining of purified VPS29 protein (Cat# TP319311). The protein was produced from HEK293T cells transfected with VPS29 cDNA clone (Cat# RC219311) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219311
• Predicted MW: 20.3 kDa
• Protein Sequence:
  Sequence Link

  >RC219311 representing NM_016226
  Red=Cloning site Green=Tags(s)
  
  MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYP
  EQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYN
  ALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057310
• RefSeq Size: 1095
• RefSeq ORF: 546
• Synonyms: DC7; DC15; PEP11
• Locus ID: 51699
• UniProt ID: Q9UBQ0
• Cytogenetics: 12q24.11
• Summary: This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex, termed the retromer complex, which is involved in retrograde transport of proteins from endosomes to the trans-Golgi network. This VPS protein may be involved in the formation of the inner shell of the retromer coat for retrograde vesicles leaving the prevacuolar compartment. Alternative splice variants encoding different isoforms and representing non-protein coding transcripts have been found for this gene. [provided by RefSeq, Aug 2013]