Kallikrein 6 (KLK6) (NM_002774) Human Mass Spec Standard

CAT#: PH318647

KLK6 MS Standard C13 and N15-labeled recombinant protein (NP_002765)

Product Images

Coomassie blue staining of purified KLK6 protein (Cat# TP318647). The protein was produced from HEK293T cells transfected with KLK6 cDNA clone (Cat# RC218647) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218647
• Predicted MW: 26.86 kDa
• Protein Sequence:
  Sequence Link

  >RC218647 representing NM_002774
  Red=Cloning site Green=Tags(s)
  
  MKKLMVVLSLIAAAWAEEQNKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQV
  FLGKHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTSCHI
  LGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGL
  VSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQAK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002765
• RefSeq Size: 1527
• RefSeq ORF: 732
• Synonyms: Bssp; hK6; Klk7; PRSS9; PRSS18; SP59
• Locus ID: 5653
• UniProt ID: Q92876, A0A024R4J8
• Cytogenetics: 19q13.41
• Summary: This gene encodes a member of the kallikrein subfamily of the peptidase S1 family of serine proteases. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The encoded preproprotein is proteolytically processed to generate the mature protease. Expression of this protease is regulated by steroid hormones and may be elevated in multiple human cancers and in serum from psoriasis patients. The encoded protease may participate in the cleavage of amyloid precursor protein and alpha-synuclein, thus implicating this protease in Alzheimer's and Parkinson's disease, respectively. This gene is located in a gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016]
• Protein Families: Druggable Genome, Protease, Secreted Protein