SCARB1 (NM_001082959) Human Mass Spec Standard

CAT#: PH318270

SCARB1 MS Standard C13 and N15-labeled recombinant protein (NP_001076428)

Product Images

Coomassie blue staining of purified SCARB1 protein (Cat# TP318270). The protein was produced from HEK293T cells transfected with SCARB1 cDNA clone (Cat# RC218270) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218270
• Predicted MW: 56 kDa
• Protein Sequence:
  Sequence Link

  >RC218270 representing NM_001082959
  Red=Cloning site Green=Tags(s)
  
  MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFF
  DVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNIL
  VLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRAVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAE
  LNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEAC
  RSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNA
  DPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESG
  AMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQGPEDTVSQPGLAAGPDRPPSPYT
  PLLPDSPSGQPPSPTA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001076428
• RefSeq Size: 2630
• RefSeq ORF: 1518
• Synonyms: CD36L1; CLA-1; CLA1; HDLQTL6; SR-BI; SRB1
• Locus ID: 949
• UniProt ID: Q8WTV0, F8W8N0
• Cytogenetics: 12q24.31
• Summary: The protein encoded by this gene is a plasma membrane receptor for high density lipoprotein cholesterol (HDL). The encoded protein mediates cholesterol transfer to and from HDL. In addition, this protein is a receptor for hepatitis C virus glycoprotein E2. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2019]
• Protein Families: Druggable Genome, Transmembrane