C17orf76 (LRRC75A) (NM_207387) Human Mass Spec Standard

CAT#: PH317603

C17orf76 MS Standard C13 and N15-labeled recombinant protein (NP_997270)

Product Images

Coomassie blue staining of purified LRRC75A protein (Cat# TP317603). The protein was produced from HEK293T cells transfected with LRRC75A cDNA clone (Cat# RC217603) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217603
• Predicted MW: 22.9 kDa
• Protein Sequence:
  Sequence Link

  >RC217603 representing NM_207387
  Red=Cloning site Green=Tags(s)
  
  MGTRQTKGSLAERASPGAAPGPRRERPDFWASLLLRAGDKAGRAGAGMPPYHRRVGMVQELLRMVRQGRR
  EEAGTLLQHLRQDLGMESTSLDDVLYRYASFRNLVDPITHDLIISLARYIHCPKPPQGCPGRKPPRQHSG
  PVGNPTDLPRPGAGDQLPTALWGAGRQRGAGLHRPHGRHGPAAAASTQHPAPPHHTGTQWQPVDPGRAAR
  PH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_997270
• RefSeq Size: 2669
• RefSeq ORF: 636
• Synonyms: C17orf76; FAM211A
• Locus ID: 388341
• UniProt ID: Q8NAA5, Q8NAA5-2
• Cytogenetics: 17p11.2