C17orf76 (LRRC75A) (NM_207387) Human Mass Spec Standard
CAT#: PH317603
C17orf76 MS Standard C13 and N15-labeled recombinant protein (NP_997270)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217603 |
Predicted MW | 22.9 kDa |
Protein Sequence |
>RC217603 representing NM_207387
Red=Cloning site Green=Tags(s) MGTRQTKGSLAERASPGAAPGPRRERPDFWASLLLRAGDKAGRAGAGMPPYHRRVGMVQELLRMVRQGRR EEAGTLLQHLRQDLGMESTSLDDVLYRYASFRNLVDPITHDLIISLARYIHCPKPPQGCPGRKPPRQHSG PVGNPTDLPRPGAGDQLPTALWGAGRQRGAGLHRPHGRHGPAAAASTQHPAPPHHTGTQWQPVDPGRAAR PH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_997270 |
RefSeq Size | 2669 |
RefSeq ORF | 636 |
Synonyms | C17orf76; FAM211A |
Locus ID | 388341 |
UniProt ID | Q8NAA5, Q8NAA5-2 |
Cytogenetics | 17p11.2 |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404000 | LRRC75A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC426437 | LRRC75A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY404000 | Transient overexpression lysate of chromosome 17 open reading frame 76 (C17orf76), transcript variant 2 |
USD 436.00 |
|
LY426437 | Transient overexpression lysate of chromosome 17 open reading frame 76 (C17orf76), transcript variant 1 |
USD 436.00 |
|
PH325515 | C17orf76 MS Standard C13 and N15-labeled recombinant protein (NP_001107039) |
USD 3,255.00 |
|
TP317603 | Recombinant protein of human chromosome 17 open reading frame 76 (C17orf76), transcript variant 2, 20 µg |
USD 867.00 |
|
TP325515 | Recombinant protein of human chromosome 17 open reading frame 76 (C17orf76), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review