FGF13 (NM_033642) Human Mass Spec Standard
CAT#: PH317121
FGF13 MS Standard C13 and N15-labeled recombinant protein (NP_378668)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217121 |
Predicted MW | 21.4 kDa |
Protein Sequence |
>RC217121 representing NM_033642
Red=Cloning site Green=Tags(s) MALLRKSYSEPQLKGIVTKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTKLYL AMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNKEGEIMKGNHVKKNKPAAH FLPKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_378668 |
RefSeq Size | 1937 |
RefSeq ORF | 576 |
Synonyms | DEE90; FGF-13; FGF2; FHF-2; FHF2; LINC00889 |
Locus ID | 2258 |
UniProt ID | Q92913 |
Cytogenetics | Xq26.3-q27.1 |
Summary | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This gene is located in a region on chromosome X, which is associated with Borjeson-Forssman-Lehmann syndrome (BFLS), making it a possible candidate gene for familial cases of the BFLS, and for other syndromal and nonspecific forms of X-linked cognitive disability mapping to this region. Alternative splicing of this gene at the 5' end results in several transcript variants encoding different isoforms with different N-termini. [provided by RefSeq, Nov 2008] |
Protein Families | Secreted Protein |
Protein Pathways | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409478 | FGF13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC418207 | FGF13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY409478 | Transient overexpression lysate of fibroblast growth factor 13 (FGF13), transcript variant 6 |
USD 436.00 |
|
LY418207 | Transient overexpression lysate of fibroblast growth factor 13 (FGF13), transcript variant 1 |
USD 436.00 |
|
TP317121 | Purified recombinant protein of Homo sapiens fibroblast growth factor 13 (FGF13), transcript variant 6, 20 µg |
USD 867.00 |
|
TP761821 | Purified recombinant protein of Human fibroblast growth factor 13 (FGF13), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review