ABHD12 (NM_001042472) Human Mass Spec Standard
CAT#: PH316963
ABHD12 MS Standard C13 and N15-labeled recombinant protein (NP_001035937)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216963 |
Predicted MW | 44.9 kDa |
Protein Sequence |
>RC216963 representing NM_001042472
Red=Cloning site Green=Tags(s) MRKRTEPVALEHERCAAAGSSSSGSAAAALDADCRLKQNLRLTGPAAAEPRCAADAGMKRALGRRKGVWL RLRKILFCVLGLYIAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEEDVTIGV WHTVPAVWWKNAQGKDQMWYEDALASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGD SVGTPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIRE EAKSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYSIAAP ARSFRDFKVQFVPFHSDLGYRHKYIYKSPELPRILREFLGKSEPEHQH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001035937 |
RefSeq Size | 1983 |
RefSeq ORF | 1194 |
Synonyms | ABHD12A; BEM46L2; C20orf22; dJ965G21.2; hABHD12; PHARC |
Locus ID | 26090 |
UniProt ID | Q8N2K0 |
Cytogenetics | 20p11.21 |
Summary | This gene encodes an enzyme that catalyzes the hydrolysis of 2-arachidonoyl glycerol (2-AG), the main endocannabinoid lipid transmitter that acts on cannabinoid receptors, CB1 and CB2. The endocannabinoid system is involved in a wide range of physiological processes, including neurotransmission, mood, appetite, pain appreciation, addiction behavior, and inflammation. Mutations in this gene are associated with the neurodegenerative disease, PHARC (polyneuropathy, hearing loss, ataxia, retinitis pigmentosa, and cataract), resulting from an inborn error of endocannabinoid metabolism. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Jan 2011] |
Protein Families | Protease, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414447 | ABHD12 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420926 | ABHD12 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414447 | Transient overexpression lysate of abhydrolase domain containing 12 (ABHD12), transcript variant 2 |
USD 436.00 |
|
LY420926 | Transient overexpression lysate of abhydrolase domain containing 12 (ABHD12), transcript variant 1 |
USD 436.00 |
|
TP316963 | Recombinant protein of human abhydrolase domain containing 12 (ABHD12), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review