SH3GL2 (NM_003026) Human Mass Spec Standard

CAT#: PH315806

SH3GL2 MS Standard C13 and N15-labeled recombinant protein (NP_003017)

Product Images

Coomassie blue staining of purified SH3GL2 protein (Cat# TP315806). The protein was produced from HEK293T cells transfected with SH3GL2 cDNA clone (Cat# RC215806) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215806
• Predicted MW: 39.8 kDa
• Protein Sequence:
  Sequence Link

  >RC215806 representing NM_003026
  Red=Cloning site Green=Tags(s)
  
  MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSM
  INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFI
  DPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIE
  QVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHT
  GTPKPSGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVAL
  PH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003017
• RefSeq Size: 2540
• RefSeq ORF: 1056
• Synonyms: CNSA2; EEN-B1; SH3D2A; SH3P4
• Locus ID: 6456
• UniProt ID: Q99962, Q7Z376
• Cytogenetics: 9p22.2
• Summary: Implicated in synaptic vesicle endocytosis. May recruit other proteins to membranes with high curvature. Required for BDNF-dependent dendrite outgrowth. Cooperates with SH3GL2 to mediate BDNF-NTRK2 early endocytic trafficking and signaling from early endosomes.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Endocytosis