TENT5C (NM_017709) Human Mass Spec Standard

CAT#: PH315475

FAM46C MS Standard C13 and N15-labeled recombinant protein (NP_060179)

Product Images

Coomassie blue staining of purified TENT5C protein (Cat# TP315475). The protein was produced from HEK293T cells transfected with TENT5C cDNA clone (Cat# RC215475) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215475
• Predicted MW: 44.9 kDa
• Protein Sequence:
  Sequence Link

  >RC215475 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRSRLEEAGIKVHDVR
  LNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRDVVLCSLLNFLPEGVNKLKISPVTLKEAYVQ
  KLVKVCTDTDRWSLISLSNKNGKNVELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSNNPISEHFHPTV
  IGESMYGDFEEAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFPD
  ILEQQRKLETYLQNHFAEEERSKYDYLMILRRVVNESTVCLMGHERRQTLNLISLLALRVLAEQNIIPSA
  TNVTCYYQPAPYVSDGNFSNYYVAHPPVTYSQPYPTWLPCN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060179
• RefSeq Size: 5720
• RefSeq ORF: 1173
• Synonyms: FAM46C
• Locus ID: 54855
• UniProt ID: Q5VWP2
• Cytogenetics: 1p12
• Summary: Nucleotidyltransferase that act as a non-canonical poly(A) RNA polymerase which enhances mRNA stability and gene expression. Mainly targets mRNAs encoding endoplasmic reticulum-targeted protein and may be involved in induction of cell death.[UniProtKB/Swiss-Prot Function]