BATF3 (NM_018664) Human Mass Spec Standard

CAT#: PH315000

BATF3 MS Standard C13 and N15-labeled recombinant protein (NP_061134)

Product Images

Coomassie blue staining of purified BATF3 protein (Cat# TP315000). The protein was produced from HEK293T cells transfected with BATF3 cDNA clone (Cat# RC215000) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215000
• Predicted MW: 14.5 kDa
• Protein Sequence:
  Sequence Link

  >RC215000 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESL
  EQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061134
• RefSeq Size: 992
• RefSeq ORF: 381
• Synonyms: JDP1; JUNDM1; SNFT
• Locus ID: 55509
• UniProt ID: Q9NR55
• Cytogenetics: 1q32.3
• Summary: This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription.[provided by RefSeq, Feb 2009]