SNX20 (NM_182854) Human Mass Spec Standard

CAT#: PH313842

SNX20 MS Standard C13 and N15-labeled recombinant protein (NP_878274)

Product Images

Coomassie blue staining of purified SNX20 protein (Cat# TP313842). The protein was produced from HEK293T cells transfected with SNX20 cDNA clone (Cat# RC213842) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213842
• Predicted MW: 36 kDa
• Protein Sequence:
  Sequence Link

  >RC213842 representing NM_182854
  Red=Cloning site Green=Tags(s)
  
  MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLPHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCR
  WKHVKLLFEIASARIEERKVSKFVVYQIIVIQTGSFDNNKAVLERRYSDFAKLQKALLKTFREEIEDVEF
  PRKHLTGNFAEEMICERRRALQEYLGLLYAIRCVRRSREFLDFLTRPELREAFGCLRAGQYPRALELLLR
  VLPLQEKLTAHCPAAAVPALCAVLLCHRDLDRPAEAFAAGERALQRLQAREGHRYYAPLLDAMVRLAYAL
  GKDFVTLQERLEESQLRRPTPRGITLKELTVREYLH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_878274
• RefSeq Size: 1457
• RefSeq ORF: 948
• Synonyms: SLIC1
• Locus ID: 124460
• UniProt ID: Q7Z614
• Cytogenetics: 16q12.1
• Summary: SNX20 interacts with the cytoplasmic domain of PSGL1 (SELPLG; MIM 600738) and cycles PSGL1 into endosomes.[supplied by OMIM, Feb 2010]