OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BCS1L (NM_001079866) Human Mass Spec Standard

Be the first to review this product
SKU
PH313712
BCS1L MS Standard C13 and N15-labeled recombinant protein (NP_001073335)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA373982 BCS1L Rabbit polyclonal Antibody
100 ul
$410.00
LY418060 Transient overexpression lysate of BCS1-like (yeast) (BCS1L), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "BCS1L or NM_001079866"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213712
Predicted MW 47.5 kDa
Protein Sequence
Protein Sequence
>RC213712 protein sequence
Red=Cloning site Green=Tags(s)

MPLSDFILALKDNPYFGAGFGLVGVGTALALARKGVQLGLVAFRRHYMITLEVPARDRSYAWLLSWLTRH
STRTQHLSVETSYLQHESGRISTKFEFVPSPGNHFIWYRGKWIRVERSREMQMIDLQTGTPWESVTFTAL
GTDRKVFFNILEEARELALQQEEGKTVMYTAVGSEWRPFGYPRRRRPLNSVVLQQGLADRIVRDVQEFID
NPKWYTDRGIPYRRGYLLYGPPGCGKSSFITALAGELEHSICLLSLTDSSLSDDRLNHLLSVAPQQSLVL
LEDVDAAFLSRDLAVENPVKYQGLGRLTFSGLLNALDGVASTEARIVFMTTNHVDRLDPALIRPGRVDLK
EYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQISPAQVQGYFMLYKNDPVGAIHNAESLRR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001073335
RefSeq Size 1454
RefSeq ORF 1257
Synonyms BCS; BCS1; BJS; FLNMS; GRACILE; h-BCS; h-BCS1; Hs.6719; MC3DN1; PTD
Locus ID 617
UniProt ID Q9Y276
Cytogenetics 2q35
Summary This gene encodes a homolog of the S. cerevisiae bcs1 protein which is involved in the assembly of complex III of the mitochondrial respiratory chain. The encoded protein does not contain a mitochondrial targeting sequence but experimental studies confirm that it is imported into mitochondria. Mutations in this gene are associated with mitochondrial complex III deficiency and the GRACILE syndrome. Several alternatively spliced transcripts encoding two different isoforms have been described. provided by RefSeq, Jan 2016
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BCS1L" proteins (7)
SKU Description Size Price
PH301195 BCS1L MS Standard C13 and N15-labeled recombinant protein (NP_004319) 10 ug
$3,360.00
LC418060 Lyophilized BCS1L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421566 Lyophilized BCS1L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418060 Transient overexpression lysate of BCS1-like (yeast) (BCS1L), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421566 Transient overexpression lysate of BCS1-like (yeast) (BCS1L), nuclear gene encoding mitochondrial protein, transcript variant 2 (as WB positive control) 100 ug
$665.00
TP301195 Recombinant protein of human BCS1-like (yeast) (BCS1L), transcript variant 1, 20 µg 20 ug
$867.00
TP313712 Recombinant protein of human BCS1-like (yeast) (BCS1L), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products