BCS1L (NM_001079866) Human Mass Spec Standard

CAT#: PH313712

BCS1L MS Standard C13 and N15-labeled recombinant protein (NP_001073335)

Product Images

Coomassie blue staining of purified BCS1L protein (Cat# TP313712). The protein was produced from HEK293T cells transfected with BCS1L cDNA clone (Cat# RC213712) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213712
• Predicted MW: 47.5 kDa
• Protein Sequence:
  Sequence Link

  >RC213712 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPLSDFILALKDNPYFGAGFGLVGVGTALALARKGVQLGLVAFRRHYMITLEVPARDRSYAWLLSWLTRH
  STRTQHLSVETSYLQHESGRISTKFEFVPSPGNHFIWYRGKWIRVERSREMQMIDLQTGTPWESVTFTAL
  GTDRKVFFNILEEARELALQQEEGKTVMYTAVGSEWRPFGYPRRRRPLNSVVLQQGLADRIVRDVQEFID
  NPKWYTDRGIPYRRGYLLYGPPGCGKSSFITALAGELEHSICLLSLTDSSLSDDRLNHLLSVAPQQSLVL
  LEDVDAAFLSRDLAVENPVKYQGLGRLTFSGLLNALDGVASTEARIVFMTTNHVDRLDPALIRPGRVDLK
  EYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQISPAQVQGYFMLYKNDPVGAIHNAESLRR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001073335
• RefSeq Size: 1454
• RefSeq ORF: 1257
• Synonyms: BCS; BCS1; BJS; FLNMS; GRACILE; h-BCS; h-BCS1; Hs.6719; MC3DN1; PTD
• Locus ID: 617
• UniProt ID: Q9Y276, A0A024R445
• Cytogenetics: 2q35
• Summary: This gene encodes a homolog of the S. cerevisiae bcs1 protein which is involved in the assembly of complex III of the mitochondrial respiratory chain. The encoded protein does not contain a mitochondrial targeting sequence but experimental studies confirm that it is imported into mitochondria. Mutations in this gene are associated with mitochondrial complex III deficiency and the GRACILE syndrome. Several alternatively spliced transcripts encoding two different isoforms have been described. [provided by RefSeq, Jan 2016]
• Protein Families: Druggable Genome