Macrophage inflammatory protein 5 (CCL15) (NM_032964) Human Mass Spec Standard

CAT#: PH312975

CCL15 MS Standard C13 and N15-labeled recombinant protein (NP_116740)

Product Images

Coomassie blue staining of purified CCL15 protein (Cat# TP312975). The protein was produced from HEK293T cells transfected with CCL15 cDNA clone (Cat# RC212975) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212975
• Predicted MW: 12.7 kDa
• Protein Sequence:
  Sequence Link

  >RC212975 representing NM_032964
  Red=Cloning site Green=Tags(s)
  
  MKVSVAALSCLMLVAVLGSQAQFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSY
  FETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_116740
• RefSeq Size: 1344
• RefSeq ORF: 339
• Synonyms: HCC-2; HMRP-2B; Lkn-1; LKN1; MIP-1d; MIP-5; NCC-3; NCC3; SCYA15; SCYL3; SY15
• Locus ID: 6359
• UniProt ID: Q16663
• Cytogenetics: 17q12
• Summary: This gene is located in a cluster of similar genes in the same region of chromosome 17. These genes encode CC cytokines, which are secreted proteins characterized by two adjacent cysteines. The product of this gene is chemotactic for T cells and monocytes, and acts through C-C chemokine receptor type 1 (CCR1). The proprotein is further processed into numerous smaller functional peptides. Naturally-occurring readthrough transcripts occur from this gene into the downstream gene, CCL14 (chemokine (C-C motif) ligand 14). [provided by RefSeq, Jan 2013]
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction