RFFL (NM_057178) Human Mass Spec Standard

CAT#: PH312645

RFFL MS Standard C13 and N15-labeled recombinant protein (NP_476519)

Product Images

Coomassie blue staining of purified RFFL protein (Cat# TP312645). The protein was produced from HEK293T cells transfected with RFFL cDNA clone (Cat# RC212645) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212645
• Predicted MW: 40.3 kDa
• Protein Sequence:
  Sequence Link

  >RC212645 representing NM_057178
  Red=Cloning site Green=Tags(s)
  
  MWATCCNWFCLDGQPEEVPPPQGARMQAYSNPGYSSFPSPTGLEPSCKSCGAHFANTARKQTCLDCKKNF
  CMTCSSQVGNGPRLCLLCQRFRATAFQREELMKMKVKDLRDYLSLHDISTEMCREKEELVLLVLGQQPVI
  SQEDRTRASTLSPDFPEQQAFLTQPHSSMVPPTSPNLPSSSAQATSVPPAQVQENQQANGHVSQDQEEPV
  YLESVARVPAEDETQSIDSEDSFVPGRRASLSDLTDLEDIEGLTVRQLKEILARNFVNYKGCCEKWELME
  RVTRLYKDQKGLQHLVSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVTCTKCGKRMNECPIC
  RQYVIRAVHVFRS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_476519
• RefSeq Size: 4143
• RefSeq ORF: 1089
• Synonyms: CARP2; fring; FYVE-RING finger protein SAKURA; RIFIFYLIN; ring finger and FYVE-like domain containing 1; RNF34L; RNF189
• Locus ID: 117584
• UniProt ID: Q8WZ73
• Cytogenetics: 17q12
• Summary: E3 ubiquitin-protein ligase that regulates several biological processes through the ubiquitin-mediated proteasomal degradation of various target proteins. Mediates 'Lys-48'-linked polyubiquitination of PRR5L and its subsequent proteasomal degradation thereby indirectly regulating cell migration through the mTORC2 complex. Ubiquitinates the caspases CASP8 and CASP10, promoting their proteasomal degradation, to negatively regulate cell death downstream of death domain receptors in the extrinsic pathway of apoptosis. Negatively regulates the tumor necrosis factor-mediated signaling pathway through targeting of RIPK1 to ubiquitin-mediated proteasomal degradation. Negatively regulates p53/TP53 through its direct ubiquitination and targeting to proteasomal degradation. Indirectly, may also negatively regulate p53/TP53 through ubiquitination and degradation of SFN. May also play a role in endocytic recycling.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome