GDPGP1 (NM_001013657) Human Mass Spec Standard

CAT#: PH312522

C15orf58 MS Standard C13 and N15-labeled recombinant protein (NP_001013679)

Product Images

Coomassie blue staining of purified GDPGP1 protein (Cat# TP312522). The protein was produced from HEK293T cells transfected with GDPGP1 cDNA clone (Cat# RC212522) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212522
• Predicted MW: 42.2 kDa
• Protein Sequence:
  Sequence Link

  >RC212522 representing NM_001013657
  Red=Cloning site Green=Tags(s)
  
  MALPHDSNETSYLLPPNNEDWGRQTIPDFVYGQKDLMAEGIQWPRNAPGIPDALPQSPFDAALCSAWKQR
  VELGLFRYRLRELQTQILPGAVGFVAQLNVERGVQRRPPQTIKSVRQAFDPVQFNFNKIRPGEVLFRLHR
  EPDLPGTLLQEDILVVINVSPLEWGHVLLVPEPARQLPQRLLPGALRAGIEAVLLSLHPGFRVGFNSLGG
  LASVNHLHLHGYYLAHRLPVEQAPSEPLDPGGHLHLLQDLPAPGFLFYTRGPGPDLESLISRVCRATDYL
  TDHEIAHNLFVTRGAPPGKTSPSSALTGVRVILWARKSSFGIKDGEAFNVALCELAGHLPVKTSQDFSSL
  TEAAAVALIQDCRLPPSQAEDVQAALVALMSQEEQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001013679
• RefSeq Size: 1940
• RefSeq ORF: 1155
• Synonyms: C15orf58; VTC2
• Locus ID: 390637
• UniProt ID: Q6ZNW5, A0A024RC68
• Cytogenetics: 15q26.1
• Summary: Specific and highly efficient GDP-D-glucose phosphorylase regulating the levels of GDP-D-glucose in cells.[UniProtKB/Swiss-Prot Function]