Myosin (MYL5) (NM_002477) Human Mass Spec Standard
CAT#: PH312414
MYL5 MS Standard C13 and N15-labeled recombinant protein (NP_002468)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212414 |
Predicted MW | 19.4 kDa |
Protein Sequence |
>RC212414 representing NM_002477
Red=Cloning site Green=Tags(s) MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLGKTNVKDD ELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEE VDQMFQFASIDVAGNLDYKALSYVITHGEEKEE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002468 |
RefSeq Size | 661 |
RefSeq ORF | 519 |
Synonyms | MYLC2 |
Locus ID | 4636 |
UniProt ID | Q02045 |
Cytogenetics | 4p16.3 |
Summary | This gene encodes one of the myosin light chains, a component of the hexameric ATPase cellular motor protein myosin. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene product, one of the regulatory light chains, is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia. [provided by RefSeq, Jul 2008] |
Protein Pathways | Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419312 | MYL5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419312 | Transient overexpression lysate of myosin, light chain 5, regulatory (MYL5) |
USD 436.00 |
|
TP312414 | Recombinant protein of human myosin, light chain 5, regulatory (MYL5), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review