Myoglobin (MB) (NM_005368) Human Mass Spec Standard
CAT#: PH312352
MB MS Standard C13 and N15-labeled recombinant protein (NP_005359)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212352 |
Predicted MW | 17 kDa |
Protein Sequence |
>RC212352 representing NM_005368
Red=Cloning site Green=Tags(s) MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVL TALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFR KDMASNYKELGFQG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005359 |
RefSeq Size | 1078 |
RefSeq ORF | 462 |
Synonyms | PVALB |
Locus ID | 4151 |
UniProt ID | P02144, A0A1K0FU49 |
Cytogenetics | 22q12.3 |
Summary | This gene encodes a member of the globin superfamily and is predominantly expressed in skeletal and cardiac muscles. The encoded protein forms a monomeric globular haemoprotein that is primarily responsible for the storage and facilitated transfer of oxygen from the cell membrane to the mitochondria. This protein also plays a role in regulating physiological levels of nitric oxide. Multiple transcript variants encoding distinct isoforms exist for this gene. [provided by RefSeq, May 2020] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404319 | MB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404320 | MB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC417346 | MB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY404319 | Transient overexpression lysate of myoglobin (MB), transcript variant 2 |
USD 436.00 |
|
LY404320 | Transient overexpression lysate of myoglobin (MB), transcript variant 3 |
USD 436.00 |
|
LY417346 | Transient overexpression lysate of myoglobin (MB), transcript variant 1 |
USD 436.00 |
|
PH303113 | MB MS Standard C13 and N15-labeled recombinant protein (NP_976312) |
USD 3,255.00 |
|
TP303113 | Recombinant protein of human myoglobin (MB), transcript variant 3, 20 µg |
USD 867.00 |
|
TP312352 | Recombinant protein of human myoglobin (MB), transcript variant 1, 20 µg |
USD 867.00 |
|
TP761636 | Purified recombinant protein of Human myoglobin (MB), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review