Myoglobin (MB) (NM_005368) Human Mass Spec Standard

CAT#: PH312352

MB MS Standard C13 and N15-labeled recombinant protein (NP_005359)

Product Images

Coomassie blue staining of purified MB protein (Cat# TP312352). The protein was produced from HEK293T cells transfected with MB cDNA clone (Cat# RC212352) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212352
• Predicted MW: 17 kDa
• Protein Sequence:
  Sequence Link

  >RC212352 representing NM_005368
  Red=Cloning site Green=Tags(s)
  
  MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVL
  TALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFR
  KDMASNYKELGFQG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005359
• RefSeq Size: 1078
• RefSeq ORF: 462
• Synonyms: PVALB
• Locus ID: 4151
• UniProt ID: P02144, A0A1K0FU49
• Cytogenetics: 22q12.3
• Summary: This gene encodes a member of the globin superfamily and is predominantly expressed in skeletal and cardiac muscles. The encoded protein forms a monomeric globular haemoprotein that is primarily responsible for the storage and facilitated transfer of oxygen from the cell membrane to the mitochondria. This protein also plays a role in regulating physiological levels of nitric oxide. Multiple transcript variants encoding distinct isoforms exist for this gene. [provided by RefSeq, May 2020]