DEFB125 (NM_153325) Human Mass Spec Standard

CAT#: PH312030

DEFB125 MS Standard C13 and N15-labeled recombinant protein (NP_697020)

Product Images

Coomassie blue staining of purified DEFB125 protein (Cat# TP312030). The protein was produced from HEK293T cells transfected with DEFB125 cDNA clone (Cat# RC212030) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212030
• Predicted MW: 17.5 kDa
• Protein Sequence:
  Sequence Link

  >RC212030 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNILMLTFIICGLLTRVTKGSFEPQKCWKNNVGHCRRRCLDTERYILLCRNKLSCCISIISHEYTRRPAF
  PVIHLEDITLDYSDVDSFTGSPVSMLNDLITFDTTKFGETMTPETNTPETTMPPSEATTPETTMPPSETA
  TSETMPPPSQTALTHN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_697020
• RefSeq Size: 709
• RefSeq ORF: 468
• Synonyms: DEFB-25
• Locus ID: 245938
• UniProt ID: Q8N687, B2R4E8
• Cytogenetics: 20p13
• Summary: Defensins are cysteine-rich cationic polypeptides that are important in the host immunologic response to invading microorganisms. The antimicrobial protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20p13. [provided by RefSeq, Nov 2014]
• Protein Families: Secreted Protein