NFKBID (NM_139239) Human Mass Spec Standard

CAT#: PH311589

NFKBID MS Standard C13 and N15-labeled recombinant protein (NP_640332)

Product Images

Coomassie blue staining of purified NFKBID protein (Cat# TP311589). The protein was produced from HEK293T cells transfected with NFKBID cDNA clone (Cat# RC211589) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211589
• Predicted MW: 33.5 kDa
• Protein Sequence:
  Sequence Link

  >RC211589 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEAGPWRVSAPPSGPPQFPAVVPGPSLEVARAHMLALGPQQLLAQDEEGDTLLHLFAARGLRWAAYAAAE
  VLQVYRRLDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAATYGLPGVLLAVLNS
  GVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTV
  LHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLE
  NEQPVHLLRPGPGPEGLRQLLKRSRVAPPGLSS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_640332
• RefSeq Size: 1834
• RefSeq ORF: 939
• Synonyms: IkappaBNS; IkBNS; TA-NFKBH
• Locus ID: 84807
• UniProt ID: Q8NI38
• Cytogenetics: 19q13.12
• Summary: Regulates the expression of IL-2, IL-6, and other cytokines through regulation on NF-kappa-B activity. Functions in the regulation of inflammatory responses. Involved in the induction of T helper 17 cells (Th17) differentiation upon recognition of antigen by T cell antigen receptor (TCR). May also regulate TCR-induced negative selection of thymocytes.[UniProtKB/Swiss-Prot Function]