TBC1D13 (NM_018201) Human Mass Spec Standard

CAT#: PH311378

TBC1D13 MS Standard C13 and N15-labeled recombinant protein (NP_060671)

Product Images

Coomassie blue staining of purified TBC1D13 protein (Cat# TP311378). The protein was produced from HEK293T cells transfected with TBC1D13 cDNA clone (Cat# RC211378) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211378
• Predicted MW: 46.6 kDa
• Protein Sequence:
  Sequence Link

  >RC211378 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSLHKSRIADFQDVLKEPSIALEKLRELSFSGIPCEGGLRCLCWKILLNYLPLERASWTSILAKQRELY
  AQFLREMIIQPGIAKANMGVSREDVTFEDHPLNPNPDSRWNTYFKDNEVLLQIDKDVRRLCPDISFFQRA
  TDYPCLLILDPQNEFETLRKRVEQTTLKSQTVARNRSGVTNMSSPHKNSVPSSLNEYEVLPNGCEAHWEV
  VERILFIYAKLNPGIAYVQGMNEIVGPLYYTFATDPNSEWKEHAEADTFFCFTNLMAEIRDNFIKSLDDS
  QCGITYKMEKVYSTLKDKDVELYLKLQEQNIKPQFFAFRWLTLLLSQEFLLPDVIRIWDSLFADDNRFDF
  LLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDSK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060671
• RefSeq Size: 3919
• RefSeq ORF: 1200
• Locus ID: 54662
• UniProt ID: Q9NVG8, A0A024R8C8, B3KNG3
• Cytogenetics: 9q34.11
• Summary: Acts as a GTPase-activating protein for RAB35. Together with RAB35 may be involved in regulation of insulin-induced glucose transporter SLC2A4/GLUT4 translocation to the plasma membrane in adipocytes.[UniProtKB/Swiss-Prot Function]