TMCO2 (NM_001008740) Human Mass Spec Standard

CAT#: PH311061

TMCO2 MS Standard C13 and N15-labeled recombinant protein (NP_001008740)

Product Images

Coomassie blue staining of purified TMCO2 protein (Cat# TP311061). The protein was produced from HEK293T cells transfected with TMCO2 cDNA clone (Cat# RC211061) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211061
• Predicted MW: 20.1 kDa
• Protein Sequence:
  Sequence Link

  >RC211061 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTSSSSSWDNLLESLSLSTVWNWIQASFLGETSAPQQTSLGLLDNLAPAVQIILRISFLILLGIGIYAL
  WKRSIQSIQKTLLFVITLYKLYKKGSHIFEALLANPEGSGLRIQDNNNLFLSLGLQEKILKKLKTVENKM
  KNLEGIIVAQKPATKRDCSSEPYCSCSDCQSPLSTSGFTSPI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001008740
• RefSeq Size: 741
• RefSeq ORF: 546
• Synonyms: dJ39G22.2
• Locus ID: 127391
• UniProt ID: Q7Z6W1, A0A140VKB8
• Cytogenetics: 1p34.2
• Protein Families: Transmembrane