WFDC6 (NM_080827) Human Mass Spec Standard

CAT#: PH310952

WFDC6 MS Standard C13 and N15-labeled recombinant protein (NP_543017)

Product Images

Coomassie blue staining of purified WFDC6 protein (Cat# TP310952). The protein was produced from HEK293T cells transfected with WFDC6 cDNA clone (Cat# RC210952) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210952
• Predicted MW: 9.7 kDa
• Protein Sequence:
  Sequence Link

  >RC210952 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGLSGLLPILVPFILLGDIQEPGHAEGILGKPCPKIKVECEVEEIDQCTKPRDCPENMKCCPFSRGKKCL
  DFRKVSLTLYHKEELE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_543017
• RefSeq Size: 619
• RefSeq ORF: 258
• Synonyms: C20orf171; dJ461P17.11; HEL-S-295; WAP6
• Locus ID: 140870
• UniProt ID: Q9BQY6, A0A0K0K1K0
• Cytogenetics: 20q13.12
• Summary: This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster. Read-through transcription exists between this gene and the upstream SPINLW1 (serine peptidase inhibitor-like, with Kunitz and WAP domains 1) gene. [provided by RefSeq, Nov 2010]
• Protein Families: Secreted Protein