DUT (NM_001025249) Human Mass Spec Standard
CAT#: PH310600
DUT MS Standard C13 and N15-labeled recombinant protein (NP_001020420)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210600 |
Predicted MW | 26.56 kDa |
Protein Sequence |
>RC210600 representing NM_001025249
Red=Cloning site Green=Tags(s) MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGA STVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYS AYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFE VKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001020420 |
RefSeq Size | 1830 |
RefSeq ORF | 756 |
Synonyms | dUTPase |
Locus ID | 1854 |
UniProt ID | P33316, A0A0C4DGL3 |
Cytogenetics | 15q21.1 |
Summary | This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400715 | DUT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422498 | DUT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400715 | Transient overexpression lysate of deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 436.00 |
|
LY422498 | Transient overexpression lysate of deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 436.00 |
|
PH321635 | DUT MS Standard C13 and N15-labeled recombinant protein (NP_001939) |
USD 3,255.00 |
|
TP310600 | Purified recombinant protein of Homo sapiens deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg |
USD 867.00 |
|
TP321635 | Recombinant protein of human deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
USD 867.00 |
|
TP720892 | Purified recombinant protein of Human deoxyuridine triphosphatase (DUT), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review