SNRPE (NM_003094) Human Mass Spec Standard
CAT#: PH310556
SNRPE MS Standard C13 and N15-labeled recombinant protein (NP_003085)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210556 |
Predicted MW | 10.6 kDa |
Protein Sequence |
>RC210556 representing NM_003094
Red=Cloning site Green=Tags(s) MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKS RKQLGRIMLKGDNITLLQSVSN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003085 |
RefSeq Size | 1593 |
RefSeq ORF | 276 |
Synonyms | HYPT11; Sm-E; SME; snRNP-E |
Locus ID | 6635 |
UniProt ID | P62304 |
Cytogenetics | 1q32.1 |
Summary | The protein encoded by this gene is a core component of U small nuclear ribonucleoproteins, which are key components of the pre-mRNA processing spliceosome. The encoded protein plays a role in the 3' end processing of histone transcripts. This protein is one of the targets in the autoimmune disease systemic lupus erythematosus, and mutations in this gene have been associated with hypotrichosis. Several pseudogenes of this gene have been identified. [provided by RefSeq, Jun 2016] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418905 | SNRPE HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY418905 | Transient overexpression lysate of small nuclear ribonucleoprotein polypeptide E (SNRPE) |
USD 436.00 |
|
TP310556 | Recombinant protein of human small nuclear ribonucleoprotein polypeptide E (SNRPE), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review