TSC22D3 (NM_004089) Human Mass Spec Standard
CAT#: PH310088
TSC22D3 MS Standard C13 and N15-labeled recombinant protein (NP_004080)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210088 |
Predicted MW | 14.8 kDa |
Protein Sequence |
>RC210088 protein sequence
Red=Cloning site Green=Tags(s) MNTEMYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVVAIDNKIEQAMDLVKNHLMYAVR EEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004080 |
RefSeq Size | 1986 |
RefSeq ORF | 402 |
Synonyms | DIP; DSIPI; GILZ; TSC-22R |
Locus ID | 1831 |
UniProt ID | Q99576 |
Cytogenetics | Xq22.3 |
Summary | This gene encodes the anti-inflammatory protein glucocorticoid (GC)-induced leucine zipper. Expression of this gene stimulated by glucocorticoids and interleukin 10 and it appears to play a key role in the anti-inflammatory and immunosuppressive effects of this steroid. This protein has also been shown to inhibit pro-inflammatory molecules including nuclear factor κB. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418232 | TSC22D3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY418232 | Transient overexpression lysate of TSC22 domain family, member 3 (TSC22D3), transcript variant 2 |
USD 436.00 |
|
TP310088 | Recombinant protein of human TSC22 domain family, member 3 (TSC22D3), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review