OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TSC22D3 (NM_004089) Human Mass Spec Standard

Be the first to review this product
SKU
PH310088
TSC22D3 MS Standard C13 and N15-labeled recombinant protein (NP_004080)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505293 TSC22D3 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11) 100 ul
$447.00
LY418232 Transient overexpression lysate of TSC22 domain family, member 3 (TSC22D3), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "TSC22D3 or NM_004089"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210088
Predicted MW 14.8 kDa
Protein Sequence
Protein Sequence
>RC210088 protein sequence
Red=Cloning site Green=Tags(s)

MNTEMYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVVAIDNKIEQAMDLVKNHLMYAVR
EEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004080
RefSeq Size 1986
RefSeq ORF 402
Synonyms DIP; DSIPI; GILZ; TSC-22R
Locus ID 1831
UniProt ID Q99576
Cytogenetics Xq22.3
Summary This gene encodes the anti-inflammatory protein glucocorticoid (GC)-induced leucine zipper. Expression of this gene stimulated by glucocorticoids and interleukin 10 and it appears to play a key role in the anti-inflammatory and immunosuppressive effects of this steroid. This protein has also been shown to inhibit pro-inflammatory molecules including nuclear factor κB. Alternate splicing results in multiple transcript variants. provided by RefSeq, Jan 2016
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TSC22D3" proteins (3)
SKU Description Size Price
LC418232 Lyophilized TSC22D3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418232 Transient overexpression lysate of TSC22 domain family, member 3 (TSC22D3), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP310088 Recombinant protein of human TSC22 domain family, member 3 (TSC22D3), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products