ATPAF1 (NM_022745) Human Mass Spec Standard

CAT#: PH309963

ATPAF1 MS Standard C13 and N15-labeled recombinant protein (NP_073582)

Product Images

Coomassie blue staining of purified ATPAF1 protein (Cat# TP309963). The protein was produced from HEK293T cells transfected with ATPAF1 cDNA clone (Cat# RC209963) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209963
• Predicted MW: 36.4 kDa
• Protein Sequence:
  Sequence Link

  >RC209963 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAVVVAAAGGAGPAVLQVAGLYRGLCAVRSRALGLGLVSPAQLRVFPVRPGSGRPEGGADGSGVGAEAE
  LQANPFYDRYRDKIQLLRRSDPAAFESRLEKRSEFRKQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTK
  DKTLSSIFNIEMVKEKTAEEIKQIWQQYFAAKDTVYAVIPAEKFDLIWNRAQSCPTFLCALPRREGYEFF
  VGQWTGTELHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAEAQCIANQVQLFY
  ATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQNKT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_073582
• RefSeq Size: 1849
• RefSeq ORF: 984
• Synonyms: ATP11; ATP11p
• Locus ID: 64756
• UniProt ID: Q5TC12, I3L448
• Cytogenetics: 1p33
• Summary: This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified. [provided by RefSeq, Aug 2011]