ATPAF1 (NM_022745) Human Mass Spec Standard
CAT#: PH309963
ATPAF1 MS Standard C13 and N15-labeled recombinant protein (NP_073582)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209963 |
Predicted MW | 36.4 kDa |
Protein Sequence |
>RC209963 protein sequence
Red=Cloning site Green=Tags(s) MAAVVVAAAGGAGPAVLQVAGLYRGLCAVRSRALGLGLVSPAQLRVFPVRPGSGRPEGGADGSGVGAEAE LQANPFYDRYRDKIQLLRRSDPAAFESRLEKRSEFRKQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTK DKTLSSIFNIEMVKEKTAEEIKQIWQQYFAAKDTVYAVIPAEKFDLIWNRAQSCPTFLCALPRREGYEFF VGQWTGTELHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAEAQCIANQVQLFY ATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQNKT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_073582 |
RefSeq Size | 1849 |
RefSeq ORF | 984 |
Synonyms | ATP11; ATP11p |
Locus ID | 64756 |
UniProt ID | Q5TC12, I3L448 |
Cytogenetics | 1p33 |
Summary | This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411584 | ATPAF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420976 | ATPAF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411584 | Transient overexpression lysate of ATP synthase mitochondrial F1 complex assembly factor 1 (ATPAF1), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 436.00 |
|
LY420976 | Transient overexpression lysate of ATP synthase mitochondrial F1 complex assembly factor 1 (ATPAF1), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 436.00 |
|
TP309963 | Recombinant protein of human ATP synthase mitochondrial F1 complex assembly factor 1 (ATPAF1), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review