SULT1A4 (NM_001017390) Human Mass Spec Standard
CAT#: PH309931
SULT1A4 MS Standard C13 and N15-labeled recombinant protein (NP_001017390)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209931 |
Predicted MW | 34.2 kDa |
Protein Sequence |
>RC209931 protein sequence
Red=Cloning site Green=Tags(s) MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKC NRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYY HFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEF VGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADY AEKMAGCSLSFRSEL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001017390 |
RefSeq Size | 1397 |
RefSeq ORF | 885 |
Synonyms | HAST3; M-PST; ST1A3; ST1A3/ST1A4; ST1A4; STM; TL-PST |
Locus ID | 445329 |
UniProt ID | P50224, P0DMM9, P0DMN0, Q1ET61 |
Cytogenetics | 16p11.2 |
Summary | Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a phenol sulfotransferase with thermolabile enzyme activity. Four sulfotransferase genes are located on the p arm of chromosome 16, this gene and SULT1A3 arose from a segmental duplication. Read-through transcription exists between this gene and the upstream SLX1B (SLX1 structure-specific endonuclease subunit homolog B) gene that encodes a protein containing GIY-YIG domains. [provided by RefSeq, Nov 2010] |
Protein Pathways | Sulfur metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422770 | SULT1A4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422771 | SULT1A4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422772 | SULT1A4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY422770 | Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4 (SULT1A4), transcript variant 1 |
USD 436.00 |
|
LY422771 | Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4 (SULT1A4), transcript variant 2 |
USD 436.00 |
|
LY422772 | Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4 (SULT1A4), transcript variant 3 |
USD 436.00 |
|
PH304897 | SULT1A4 MS Standard C13 and N15-labeled recombinant protein (NP_001017391) |
USD 3,255.00 |
|
PH322321 | SULT1A4 MS Standard C13 and N15-labeled recombinant protein (NP_001017389) |
USD 3,255.00 |
|
TP304897 | Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4 (SULT1A4), transcript variant 3, 20 µg |
USD 867.00 |
|
TP309931 | Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4 (SULT1A4), transcript variant 2, 20 µg |
USD 867.00 |
|
TP322321 | Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4 (SULT1A4), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review