CWC15 (NM_016403) Human Mass Spec Standard

CAT#: PH308046

CWC15 MS Standard C13 and N15-labeled recombinant protein (NP_057487)

Product Images

Coomassie blue staining of purified CWC15 protein (Cat# TP308046). The protein was produced from HEK293T cells transfected with CWC15 cDNA clone (Cat# RC208046) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208046
• Predicted MW: 26.6 kDa
• Protein Sequence:
  Sequence Link

  >RC208046 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAA
  AREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKER
  AEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGVDDQKKDKRF
  VNDTLRSEFHKKFMEKYIK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057487
• RefSeq Size: 1592
• RefSeq ORF: 687
• Synonyms: AD002; C11orf5; Cwf15; HSPC148; ORF5
• Locus ID: 51503
• UniProt ID: Q9P013
• Cytogenetics: 11q21
• Summary: Involved in pre-mRNA splicing as component of the spliceosome (PubMed:28502770, PubMed:28076346). Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Spliceosome