MD1 (LY86) (NM_004271) Human Mass Spec Standard

CAT#: PH307913

LY86 MS Standard C13 and N15-labeled recombinant protein (NP_004262)

Product Images

Coomassie blue staining of purified LY86 protein (Cat# TP307913). The protein was produced from HEK293T cells transfected with LY86 cDNA clone (Cat# RC207913) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207913
• Predicted MW: 17.9 kDa
• Protein Sequence:
  Sequence Link

  >RC207913 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRF
  GIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQV
  LLELYTEKRSTVACANATIMCS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004262
• RefSeq Size: 895
• RefSeq ORF: 486
• Synonyms: dJ80N2.1; MD-1; MD1; MMD-1
• Locus ID: 9450
• UniProt ID: O95711
• Cytogenetics: 6p25.1
• Summary: May cooperate with CD180 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS) and cytokine production. Important for efficient CD180 cell surface expression (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein