OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ERP27 (NM_152321) Human Mass Spec Standard

Be the first to review this product
SKU
PH306683
ERP27 MS Standard C13 and N15-labeled recombinant protein (NP_689534)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365767 ERP27 rabbit polyclonal antibody
100 ul
$310.00
LY407647 Transient overexpression lysate of endoplasmic reticulum protein 27 (ERP27) (as WB positive control) 100 ug
$436.00

Other products for "ERP27 or NM_152321"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206683
Predicted MW 30.5 kDa
Protein Sequence
Protein Sequence
>RC206683 protein sequence
Red=Cloning site Green=Tags(s)

MEAAPSRFMFLLFLLTCELAAEVAAEVEKSSDGPGAAQEPTWLTDVPAAMEFIAATEVAVIGFFQDLEIP
AVPILHSMVQKFPGVSFGISTDSEVLTHYNITGNTICLFRLVDNEQLNLEDEDIESIDATKLSRFIEINS
LHMVTEYNPVTVIGLFNSVIQIHLLLIMNKASPEYEENMHRYQKAAKLFQGKILFILVDSGMKENGKVIS
FFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHVQNFCDGFLSGKLLKENRESEGKTPKVEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689534
RefSeq Size 1581
RefSeq ORF 819
Synonyms C12orf46; PDIA8
Locus ID 121506
UniProt ID Q96DN0
Cytogenetics 12p12.3
Summary This gene encodes a noncatalytic member of the protein disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins. The canonical protein has an N-terminal signal sequence, two thioredoxin (TRX)-like domains and a C-terminal ER-retention sequence. Alternative splicing results in multiple transcript variants encoding distinct isoforms; some of which lack domains present in the canonical protein. provided by RefSeq, Dec 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ERP27" proteins (3)
SKU Description Size Price
LC407647 Lyophilized ERP27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407647 Transient overexpression lysate of endoplasmic reticulum protein 27 (ERP27) (as WB positive control) 100 ug
$436.00
TP306683 Recombinant protein of human endoplasmic reticulum protein 27 (ERP27), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products