ERP27 (NM_152321) Human Mass Spec Standard
CAT#: PH306683
ERP27 MS Standard C13 and N15-labeled recombinant protein (NP_689534)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206683 |
Predicted MW | 30.5 kDa |
Protein Sequence |
>RC206683 protein sequence
Red=Cloning site Green=Tags(s) MEAAPSRFMFLLFLLTCELAAEVAAEVEKSSDGPGAAQEPTWLTDVPAAMEFIAATEVAVIGFFQDLEIP AVPILHSMVQKFPGVSFGISTDSEVLTHYNITGNTICLFRLVDNEQLNLEDEDIESIDATKLSRFIEINS LHMVTEYNPVTVIGLFNSVIQIHLLLIMNKASPEYEENMHRYQKAAKLFQGKILFILVDSGMKENGKVIS FFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHVQNFCDGFLSGKLLKENRESEGKTPKVEL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_689534 |
RefSeq Size | 1581 |
RefSeq ORF | 819 |
Synonyms | C12orf46; PDIA8 |
Locus ID | 121506 |
UniProt ID | Q96DN0 |
Cytogenetics | 12p12.3 |
Summary | This gene encodes a noncatalytic member of the protein disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins. The canonical protein has an N-terminal signal sequence, two thioredoxin (TRX)-like domains and a C-terminal ER-retention sequence. Alternative splicing results in multiple transcript variants encoding distinct isoforms; some of which lack domains present in the canonical protein. [provided by RefSeq, Dec 2016] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407647 | ERP27 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY407647 | Transient overexpression lysate of endoplasmic reticulum protein 27 (ERP27) |
USD 436.00 |
|
TP306683 | Recombinant protein of human endoplasmic reticulum protein 27 (ERP27), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review