CST9L (NM_080610) Human Mass Spec Standard

CAT#: PH306646

CST9L MS Standard C13 and N15-labeled recombinant protein (NP_542177)

Product Images

Coomassie blue staining of purified CST9L protein (Cat# TP306646). The protein was produced from HEK293T cells transfected with CST9L cDNA clone (Cat# RC206646) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206646
• Predicted MW: 17.3 kDa
• Protein Sequence:
  Sequence Link

  >RC206646 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLGLPWKGGLSWALLLLLLGSQILLIYAWHFHEQRDCDEHNVMARYLPATVEFAVHTFNQQSKDYYAYRL
  GHILNSWKEQVESKTVFSMELLLGRTRCGKFEDDIDNCHFQESTELNNTFTCFFTISTRPWMTQFSLLNK
  TCLEGFH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_542177
• RefSeq Size: 982
• RefSeq ORF: 441
• Synonyms: bA218C14.1; CTES7B
• Locus ID: 128821
• UniProt ID: Q9H4G1, A0A140VJH1
• Cytogenetics: 20p11.21
• Summary: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein similar to mouse cystatin 9. Based on its testis-specific expression, it is likely to have a role in tissue reorganization during early testis development. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein, Transmembrane