OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CST9L (NM_080610) Human Mass Spec Standard

Be the first to review this product
SKU
PH306646
CST9L MS Standard C13 and N15-labeled recombinant protein (NP_542177)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA316094 Rabbit polyclonal anti-CST9L antibody
100 ul
$380.00
LY409153 Transient overexpression lysate of cystatin 9-like (CST9L) (as WB positive control) 100 ug
$436.00

Other products for "CST9L or NM_080610"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206646
Predicted MW 17.3 kDa
Protein Sequence
Protein Sequence
>RC206646 protein sequence
Red=Cloning site Green=Tags(s)

MLGLPWKGGLSWALLLLLLGSQILLIYAWHFHEQRDCDEHNVMARYLPATVEFAVHTFNQQSKDYYAYRL
GHILNSWKEQVESKTVFSMELLLGRTRCGKFEDDIDNCHFQESTELNNTFTCFFTISTRPWMTQFSLLNK
TCLEGFH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542177
RefSeq Size 982
RefSeq ORF 441
Synonyms bA218C14.1; CTES7B
Locus ID 128821
UniProt ID Q9H4G1
Cytogenetics 20p11.21
Summary The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein similar to mouse cystatin 9. Based on its testis-specific expression, it is likely to have a role in tissue reorganization during early testis development. provided by RefSeq, Jul 2008
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CST9L" proteins (3)
SKU Description Size Price
LC409153 Lyophilized CST9L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409153 Transient overexpression lysate of cystatin 9-like (CST9L) (as WB positive control) 100 ug
$436.00
TP306646 Recombinant protein of human cystatin 9-like (CST9L), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products