TRF1 (TERF1) (NM_003218) Human Mass Spec Standard
CAT#: PH305904
TERF1 MS Standard C13 and N15-labeled recombinant protein (NP_003209)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205904 |
Predicted MW | 48.2 kDa |
Protein Sequence |
>RC205904 protein sequence
Red=Cloning site Green=Tags(s) MAEDVSSAAPSPRGCADGRDADPTEEQMAETERNDEEQFECQELLECQVQVGAPEEEEEEEEDAGLVAEA EAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQLRTIYICQFLTRIAAGKTLDA QFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDPNSHMPF KSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVESKRTRTITSQDKPSG NDVEMETEANLDTRKRSHKNLFLSKLQHGTQQQDLNKKERRVGTPQSTKKKKESRRATESRIPVSKSQPV TPEKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKLKLISSDSED myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003209 |
RefSeq Size | 2900 |
RefSeq ORF | 1257 |
Synonyms | hTRF1-AS; PIN2; t-TRF1; TRBF1; TRF; TRF1 |
Locus ID | 7013 |
UniProt ID | P54274, P54274-2 |
Cytogenetics | 8q21.11 |
Summary | This gene encodes a telomere specific protein which is a component of the telomere nucleoprotein complex. This protein is present at telomeres throughout the cell cycle and functions as an inhibitor of telomerase, acting in cis to limit the elongation of individual chromosome ends. The protein structure contains a C-terminal Myb motif, a dimerization domain near its N-terminus and an acidic N-terminus. Two transcripts of this gene are alternatively spliced products. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413770 | TERF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC418833 | TERF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413770 | Transient overexpression lysate of telomeric repeat binding factor (NIMA-interacting) 1 (TERF1), transcript variant 1 |
USD 665.00 |
|
LY418833 | Transient overexpression lysate of telomeric repeat binding factor (NIMA-interacting) 1 (TERF1), transcript variant 2 |
USD 436.00 |
|
TP305904 | Recombinant protein of human telomeric repeat binding factor (NIMA-interacting) 1 (TERF1), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review