C9orf23 (RPP25L) (NM_148178) Human Mass Spec Standard

CAT#: PH305700

C9orf23 MS Standard C13 and N15-labeled recombinant protein (NP_680544)

Product Images

Coomassie blue staining of purified RPP25L protein (Cat# TP305700). The protein was produced from HEK293T cells transfected with RPP25L cDNA clone (Cat# RC205700) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205700
• Predicted MW: 17.6 kDa
• Protein Sequence:
  Sequence Link

  >RC205700 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSC
  AEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPP
  GLGSMPSSSCGPRSRRRARDTRS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_680544
• RefSeq Size: 915
• RefSeq ORF: 489
• Synonyms: bA296L22.5; C9orf23
• Locus ID: 138716
• UniProt ID: Q8N5L8
• Cytogenetics: 9p13.3
• Summary: This gene encodes a protein that appears to belong to a family of evolutionarily related proteins (DUF78), that may share one or more domains in common. Members of this family are small archaebacterial proteins with no known function. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]