C9orf23 (RPP25L) (NM_148178) Human Mass Spec Standard
CAT#: PH305700
C9orf23 MS Standard C13 and N15-labeled recombinant protein (NP_680544)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205700 |
Predicted MW | 17.6 kDa |
Protein Sequence |
>RC205700 protein sequence
Red=Cloning site Green=Tags(s) MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSC AEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPP GLGSMPSSSCGPRSRRRARDTRS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_680544 |
RefSeq Size | 915 |
RefSeq ORF | 489 |
Synonyms | bA296L22.5; C9orf23 |
Locus ID | 138716 |
UniProt ID | Q8N5L8 |
Cytogenetics | 9p13.3 |
Summary | This gene encodes a protein that appears to belong to a family of evolutionarily related proteins (DUF78), that may share one or more domains in common. Members of this family are small archaebacterial proteins with no known function. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407738 | RPP25L HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC407739 | RPP25L HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY407738 | Transient overexpression lysate of chromosome 9 open reading frame 23 (C9orf23), transcript variant 1 |
USD 436.00 |
|
LY407739 | Transient overexpression lysate of chromosome 9 open reading frame 23 (C9orf23), transcript variant 2 |
USD 436.00 |
|
PH323396 | C9orf23 MS Standard C13 and N15-labeled recombinant protein (NP_680545) |
USD 3,255.00 |
|
TP305700 | Recombinant protein of human chromosome 9 open reading frame 23 (C9orf23), transcript variant 1, 20 µg |
USD 867.00 |
|
TP323396 | Recombinant protein of human chromosome 9 open reading frame 23 (C9orf23), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review