ZCRB1 (NM_033114) Human Mass Spec Standard

CAT#: PH305492

ZCRB1 MS Standard C13 and N15-labeled recombinant protein (NP_149105)

Product Images

Coomassie blue staining of purified ZCRB1 protein (Cat# TP305492). The protein was produced from HEK293T cells transfected with ZCRB1 cDNA clone (Cat# RC205492) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205492
• Predicted MW: 24.6 kDa
• Protein Sequence:
  Sequence Link

  >RC205492 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRA
  INNKQLFGRVIKASIAIDNGRAAEFIRRRNYFDKSKCYECGESGHLSYACPKNMLGEREPQKKKEKKKKK
  KAPEPEEEIEEVEESEDEGEDPALDSLSQAIAFQQAKIEEEQKKWKPSSGVPSTSDDSRRPRIKKSTYFS
  DEEELSD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_149105
• RefSeq Size: 1844
• RefSeq ORF: 651
• Synonyms: MADP-1; MADP1; RBM36; SNRNP31; ZCCHC19
• Locus ID: 85437
• UniProt ID: Q8TBF4, A0A024R106
• Cytogenetics: 12q12
• Summary: Pre-mRNA splicing is catalyzed by the spliceosome. U12-type spliceosome binds U12-type pre-mRNAs and recognizes the 5' splice site and branch-point sequence. U11 and U12 snRNPs are components of U12-type spliceosome and function as a molecular bridge connecting both ends of the intron. The protein encoded by this gene contains a RNA recognition motif. It was identified as one of the protein components of U11/U12 snRNPs. This protein and many other U11/U12 snRNP proteins are highly conserved in organisms known to contain U12-type introns. These proteins have been shown to be essential for cell viability, suggesting the key roles in U12-type splicing. [provided by RefSeq, Jul 2008]