Calponin (CNN1) (NM_001299) Human Mass Spec Standard

CAT#: PH305370

CNN1 MS Standard C13 and N15-labeled recombinant protein (NP_001290)

Product Images

Coomassie blue staining of purified CNN1 protein (Cat# TP305370). The protein was produced from HEK293T cells transfected with CNN1 cDNA clone (Cat# RC205370) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205370
• Predicted MW: 33.2 kDa
• Protein Sequence:
  Sequence Link

  >RC205370 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIILCEFINKLQPG
  SVKKINESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQVQSTLLALASMAKTKGNKVNV
  GVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTDQPLDQATISLQMGT
  NKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPE
  LGEPAHNHHAHNYYNSA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001290
• RefSeq Size: 1599
• RefSeq ORF: 891
• Synonyms: HEL-S-14; Sm-Calp; SMCC
• Locus ID: 1264
• UniProt ID: P51911, V9HWA5
• Cytogenetics: 19p13.2
• Summary: Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity (By similarity).[UniProtKB/Swiss-Prot Function]