LY6H (NM_002347) Human Mass Spec Standard
CAT#: PH305136
LY6H MS Standard C13 and N15-labeled recombinant protein (NP_002338)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205136 |
Predicted MW | 14.7 kDa |
Protein Sequence |
>RC205136 protein sequence
Red=Cloning site Green=Tags(s) MLPAAMKGLGLALLAVLLCSAPAHGLWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVN KMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002338 |
RefSeq Size | 950 |
RefSeq ORF | 420 |
Synonyms | NMLY6 |
Locus ID | 4062 |
UniProt ID | O94772 |
Cytogenetics | 8q24.3 |
Summary | Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4-containing nAChRs maximum response. May play a role in the intracellular trafficking of alpha-7-containing nAChRs and may inhibit their expression at the cell surface. Seems to inhibit alpha-7/CHRNA7 signaling in hippocampal neurons.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419383 | LY6H HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419383 | Transient overexpression lysate of lymphocyte antigen 6 complex, locus H (LY6H), transcript variant 1 |
USD 436.00 |
|
TP305136 | Recombinant protein of human lymphocyte antigen 6 complex, locus H (LY6H), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review