LY6H (NM_002347) Human Mass Spec Standard

CAT#: PH305136

LY6H MS Standard C13 and N15-labeled recombinant protein (NP_002338)

Product Images

Coomassie blue staining of purified LY6H protein (Cat# TP305136). The protein was produced from HEK293T cells transfected with LY6H cDNA clone (Cat# RC205136) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205136
• Predicted MW: 14.7 kDa
• Protein Sequence:
  Sequence Link

  >RC205136 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLPAAMKGLGLALLAVLLCSAPAHGLWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVN
  KMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002338
• RefSeq Size: 950
• RefSeq ORF: 420
• Synonyms: NMLY6
• Locus ID: 4062
• UniProt ID: O94772
• Cytogenetics: 8q24.3
• Summary: Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4-containing nAChRs maximum response. May play a role in the intracellular trafficking of alpha-7-containing nAChRs and may inhibit their expression at the cell surface. Seems to inhibit alpha-7/CHRNA7 signaling in hippocampal neurons.[UniProtKB/Swiss-Prot Function]